PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000189.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 242aa    MW: 27298.8 Da    PI: 9.5498
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000189.1_g00014.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM162.91.2e-50141381128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelvv+yLk+kv + +l++ ++i+++d++k++PwdLp      e+e yfFs+r+ ky++g+r++rat sgyWkat
  Itr_sc000189.1_g00014.1  14 LPPGFRFHPTDEELVVQYLKRKVFSCPLPA-SIIPDFDVCKSDPWDLPGD---WEQERYFFSTREVKYPNGNRSSRATGSGYWKAT 95 
                              79****************************.89***************44...46799**************************** PP

                      NAM  87 gkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ s  +++lvg+kktLvfykg+ap+g++tdW+mheyrl
  Itr_sc000189.1_g00014.1  96 GIDKQIASCrGRQLVGMKKTLVFYKGKAPHGSRTDWIMHEYRL 138
                              ******99757778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-615162IPR003441NAC domain
PROSITE profilePS5100557.89214162IPR003441NAC domain
PfamPF023655.8E-2715138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MEKMSFVKNG VLRLPPGFRF HPTDEELVVQ YLKRKVFSCP LPASIIPDFD VCKSDPWDLP  60
GDWEQERYFF STREVKYPNG NRSSRATGSG YWKATGIDKQ IASCRGRQLV GMKKTLVFYK  120
GKAPHGSRTD WIMHEYRLAN APTSQHPPNN NQNWVLCRVF LKKRPGKKED EETEMRGAAS  180
LGNGTKPVFY DFLARERADL NLAPASSSSG SSGVTVLSSN HQTEDHEESS SCSSFTTLRT  240
KP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-511216815171NAC domain-containing protein 19
4dul_A5e-511216815171NAC domain-containing protein 19
1ut7_B5e-511216815171NO APICAL MERISTEM PROTEIN
1ut7_A5e-511216815171NO APICAL MERISTEM PROTEIN
1ut4_B5e-511216815171NO APICAL MERISTEM PROTEIN
1ut4_A5e-511216815171NO APICAL MERISTEM PROTEIN
3swp_D6e-511216818174NAC domain-containing protein 19
3swp_C6e-511216818174NAC domain-containing protein 19
3swp_B6e-511216818174NAC domain-containing protein 19
3swp_A6e-511216818174NAC domain-containing protein 19
3swm_D6e-511216818174NAC domain-containing protein 19
3swm_C6e-511216818174NAC domain-containing protein 19
3swm_B6e-511216818174NAC domain-containing protein 19
3swm_A6e-511216818174NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086848.11e-125PREDICTED: NAC transcription factor 25
SwissprotQ9FY931e-105NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0M4FP121e-123A0A0M4FP12_MANES; NAC transcription factors 34
STRINGPOPTR_0001s13380.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13872377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.11e-105NAC domain containing protein 83